PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_137934g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 363aa    MW: 40760.6 Da    PI: 4.5763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_137934g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++lv +++++G g+W++ ++  g+ R++k+c++rw +yl
   MA_137934g0010 14 KGSWTLDEDQILVSYINKHGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     799*****************************99************97 PP

2Myb_DNA-binding47.63.8e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE++ +++++++ G++ W+tIa++++ gRt++++k+ w 
   MA_137934g0010  67 RGNFSPEEEDHIIKLHQLIGNR-WSTIASYLP-GRTDNEIKNVWS 109
                      89********************.*********.*********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.007961IPR017930Myb domain
SuperFamilySSF466894.49E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-151461IPR001005SANT/Myb domain
CDDcd001675.27E-111661No hitNo description
PROSITE profilePS5129422.46462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1166114IPR001005SANT/Myb domain
PfamPF002491.5E-1367109IPR001005SANT/Myb domain
CDDcd001674.71E-869108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRAPCCDKM GVKKGSWTLD EDQILVSYIN KHGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDLKRGNF SPEEEDHIIK LHQLIGNRWS TIASYLPGRT DNEIKNVWST RLKKRLSRMK  120
DKSVAVDAQP APSSSLDSST EEMAYHGSNP LSLQILCNSD ARAPSAWEIC DPIYVSPEFS  180
EDVISSSYKV CTSTRDYQST SSDSTLDVLH SDCIDSLELE IDHSSLSINT VDELECQPLS  240
RDPQIFIAND RNNFEDPAGL PAIARDDKAE MVTSIRPACD GEIIISDESL NSSINLQVDS  300
PMQQFYGAEI DWLIDHADNM SPAMDSNRFA INTNQLWSAD LQVGEGMDYW LNILKQVEPL  360
PLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25141167108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6785020.0EF678502.1 Picea sitchensis clone WS02925_J15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LRH40.0B8LRH4_PICSI; Putative uncharacterized protein
STRINGfgenesh2_kg.3__2539__AT3G23250.19e-67(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-68myb domain protein 15